BACK HOME

P27797 Proteins with OtherRepeats Repeats

Uniprot ID: P27797	Protein name : Calreticulin	Gene : CALR CRTC
Protein Families : Calreticulin family	Squence Length : 417

Sequence	>P27797 418 MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Repeat regions	REPEAT 191 202 1-1 REPEAT 210 221 1-2 REPEAT 227 238 1-3 REPEAT 244 255 1-4 REPEAT 259 269 2-1 REPEAT 273 283 2-2 REPEAT 287 297 2-3
Sequence region of repeats	191- 202 SGSLEDDWDFLP 210- 221 DASKPEDWDERA 227- 238 TDSKPEDWDKPE 244- 255 DAKKPEDWDEEM 259- 269 WEPPVIQNPEY 273- 283 WKPRQIDNPDY 287- 297 WIHPEIDNPEY
Function	"Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity)"
Motifs	MOTIF 414 417 Prevents secretion from ER
Binding Site	BINDING 109 109 Carbohydrate. BINDING 111 111 Carbohydrate. BINDING 128 128 Carbohydrate. BINDING 135 135 Carbohydrate. BINDING 317 317 Carbohydrate
Mutation