BACK
HOME
P59990 Proteins with OtherRepeats Repeats
Uniprot ID: P59990
Protein name : Keratin-associated protein 12-1
Gene : KRTAP12-1 KAP12.1 KRTAP12.1
Protein Families : KRTAP type 12 family
Squence Length : 96
Sequence
>P59990 97 MCHTSCSSGCQPACCAPSPCQASCYIPVGCQSSVCVPVSFKPAVCVPVRCQSSVCVPVSCRPVVYAAPSCQSSGCCQPSCTSVLCRPISCSTPSCC
Repeat regions
REPEAT 10 14 1 REPEAT 15 19 2 REPEAT 24 28 3 REPEAT 30 34 4 REPEAT 35 39 5 REPEAT 45 49 6 REPEAT 50 54 7 REPEAT 55 59 8 REPEAT 60 64 9 REPEAT 70 74 10 REPEAT 75 79 11 REPEAT 80 84 12 REPEAT 85 89 13 REPEAT 90 94 14
Sequence region of repeats
10- 14 PACCA 15- 19 PSPCQ 24- 28 IPVGC 30- 34 SSVCV 35- 39 PVSFK 45- 49 PVRCQ 50- 54 SSVCV 55- 59 PVSCR 60- 64 PVVYA 70- 74 SSGCC 75- 79 QPSCT 80- 84 SVLCR 85- 89 PISCS 90- 94 TPSCC
Function
"In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
Mutation