BACK
HOME
P60329 Proteins with OtherRepeats Repeats
Uniprot ID: P60329
Protein name : Keratin-associated protein 12-4
Gene : KRTAP12-4 KAP12.4 KRTAP12.4
Protein Families : KRTAP type 12 family
Squence Length : 112
Sequence
>P60329 113 MCHTSHSSGCPMACPGSPCCVPSTCYPPEGYGTSCCCSAPCVALLCRPLCGVSTCCQPACCVPSPCQVACCVPVSCKPVLCVASFCPTSGCCQPFCPTLVYRPVTWSTPTGC
Repeat regions
REPEAT 10 14 1 REPEAT 20 24 2 REPEAT 25 29 3 REPEAT 35 39 4 REPEAT 41 45 5 REPEAT 46 50 6 REPEAT 56 60 7 REPEAT 61 65 8 REPEAT 66 70 9 REPEAT 71 75 10 REPEAT 76 80 11 REPEAT 81 85 12 REPEAT 86 90 13 REPEAT 91 95 14 REPEAT 96 100 15
Sequence region of repeats
10- 14 MACPG 20- 24 PSTCY 25- 29 PPEGY 35- 39 CSAPC 41- 45 ALLCR 46- 50 PLCGV 56- 60 PACCV 61- 65 PSPCQ 66- 70 VACCV 71- 75 PVSCK 76- 80 PVLCV 81- 85 ASFCP 86- 90 TSGCC 91- 95 QPFCP 96- 100 TLVYR
Function
"In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
Mutation