BACK HOME

P60412 Proteins with OtherRepeats Repeats

Uniprot ID: P60412	Protein name : Keratin-associated protein 10-11	Gene : KRTAP10-11 KAP10.11 KAP18-11 KRTAP10.11 KRTAP18-11 KRTAP18.11
Protein Families : KRTAP type 10 family	Squence Length : 298

Sequence	>P60412 299 MAASTMSVCSSAYSDSWQVDDCPESCCEPPCSAPSCCAPAPSLSLVCTPVSCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKTVCCKPVCCVPVCCGAASSCCRQSSCQPACCASSSCQPACCVPVCCKPVCCVSTCSEDSSSCCQQSSCQPACCTSSSYQQACCVPVCCKTVYCKPICCVPVCSRASSSRCQQPSCQPACCTTSCCRPSSSVSLLCHPVCRSTCCVPVSSCCAPTSSCQSSCCRPASCVSLLCRPASSRLACYSLCSGKKSSC
Repeat regions	REPEAT 26 30 1 REPEAT 36 40 2 REPEAT 57 61 3 REPEAT 79 83 4 REPEAT 89 93 5 REPEAT 99 103 6 REPEAT 104 108 7 REPEAT 109 113 8 REPEAT 114 118 9 REPEAT 119 123 10 REPEAT 126 130 11 REPEAT 136 140 12 REPEAT 146 150 13 REPEAT 151 155 14 REPEAT 156 160 15 REPEAT 168 172 16 REPEAT 178 182 17 REPEAT 188 192 18 REPEAT 193 197 19 REPEAT 203 207 20 REPEAT 225 229 21 REPEAT 230 234 22 REPEAT 249 253 23 REPEAT 256 260 24 REPEAT 267 271 25
Sequence region of repeats	26- 30 EPPCS 36- 40 APAPS 57- 61 QAACE 79- 83 QQSSC 89- 93 TSSPC 99- 103 VPVCC 104- 108 KTVCC 109- 113 KPVCC 114- 118 VPVCC 119- 123 GAASS 126- 130 RQSSC 136- 140 ASSSC 146- 150 VPVCC 151- 155 KPVCC 156- 160 VSTCS 168- 172 QQSSC 178- 182 TSSSY 188- 192 VPVCC 193- 197 KTVYC 203- 207 VPVCS 225- 229 TTSCC 230- 234 RPSSS 249- 253 VPVSS 256- 260 APTSS 267- 271 RPASC
Function	"In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
Mutation