BACK
HOME
Q6L8G5 Proteins with OtherRepeats Repeats
Uniprot ID: Q6L8G5
Protein name : Keratin-associated protein 5-10
Gene : KRTAP5-10 KAP5.10 KRTAP5.10
Protein Families : KRTAP type 5 family
Squence Length : 202
Sequence
>Q6L8G5 203 MGCCGCSGGCGSGCGGCGSGCGGCGSGCGGYGSGCGGCGSSCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGDCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQCNCCKPCCCSSGCGSCCQSSCCNPCCCQSSCCVPVCCQSSCCKPCCCQSSCCVPVCCQCKI
Repeat regions
REPEAT 48 51 1 REPEAT 54 57 2 REPEAT 144 147 3 REPEAT 162 165 4 REPEAT 172 175 5 REPEAT 182 185 6 REPEAT 192 195 7
Sequence region of repeats
48- 51 KPVC 54- 57 VPAC 144- 147 KPCC 162- 165 NPCC 172- 175 VPVC 182- 185 KPCC 192- 195 VPVC
Function
"In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
Mutation