BACK
HOME
Q6L8G8 Proteins with OtherRepeats Repeats
Uniprot ID: Q6L8G8
Protein name : Keratin-associated protein 5-7
Gene : KRTAP5-7 KAP5-7 KAP5.3 KRTAP5.3 KRTAP5.7
Protein Families : KRTAP type 5 family
Squence Length : 165
Sequence
>Q6L8G8 166 MGCCGCSEGCGSGCGGCGSGCGGCGSGCGGCGSSCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCCQSSCCKPCCCSSGCGSSCCQSSCCNPCCSQSSCCVPVCCQCKI
Repeat regions
REPEAT 35 38 1 REPEAT 41 44 2 REPEAT 47 50 3 REPEAT 116 119 4 REPEAT 126 129 5 REPEAT 145 148 6 REPEAT 155 158 7
Sequence region of repeats
35- 38 VPVC 41- 44 KPVC 47- 50 VPAC 116- 119 KPCC 126- 129 KPCC 145- 148 NPCC 155- 158 VPVC
Function
"In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
Mutation