BACK HOME

Q6L8H1 Proteins with OtherRepeats Repeats

Uniprot ID: Q6L8H1	Protein name : Keratin-associated protein 5-4	Gene : KRTAP5-4 KAP5.4 KRTAP5.4
Protein Families : KRTAP type 5 family	Squence Length : 288

Sequence	>Q6L8H1 289 MGCCGCSGGCGSGCGGCGSGCGGCGSGCGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGYGSCGGSKGGCVSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCVSCGGSKGGCGSCGGSKGGCVSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCCKPCCCSSGCGSSCCQSSCCKPCCSSSGCGSSCCQSSCCKPYCCQSSCCKPCCSSSGCGSSCCQSSCCNPCCSQSSCCVPVCCQCKI
Repeat regions	REPEAT 49 52 1 REPEAT 55 58 2 REPEAT 61 64 3 REPEAT 201 204 4 REPEAT 220 223 5 REPEAT 239 242 6 REPEAT 249 252 7 REPEAT 268 271 8 REPEAT 278 281 9
Sequence region of repeats	49- 52 VPIC 55- 58 KPVC 61- 64 VPAC 201- 204 KPCC 220- 223 KPCC 239- 242 KPYC 249- 252 KPCC 268- 271 NPCC 278- 281 VPVC
Function	"In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
Mutation