BACK HOME

Q701N2 Proteins with OtherRepeats Repeats

Uniprot ID: Q701N2	Protein name : Keratin-associated protein 5-5	Gene : KRTAP5-5 KAP5-11 KAP5.5 KRTAP5-11 KRTAP5.11 KRTAP5.5
Protein Families : KRTAP type 5 family	Squence Length : 237

Sequence	>Q701N2 238 MGCCGCSGGCGSGCGGRGSGCGGCGSGCGGCGSGCGGCGSGCGGCGGCGSGCAGCGGCGSGCCVPVCCCKPMCCCVPACSCSSCGKGGCGSCGGSKRGCVSCGVSKGACGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSYGCSQSSCCKPCCCSSGCGSSCCQSSCCKPYCCQSSCCKPYCCQSSCCKPCSCFSGCGSSCCQSSCYKPCCCQSSCCVPVCCQCKI
Repeat regions	REPEAT 62 65 1 REPEAT 68 71 2 REPEAT 74 77 3 REPEAT 159 162 4 REPEAT 178 181 5 REPEAT 188 191 6 REPEAT 198 201 7 REPEAT 227 230 8
Sequence region of repeats	62- 65 VPVC 68- 71 KPMC 74- 77 VPAC 159- 162 KPCC 178- 181 KPYC 188- 191 KPYC 198- 201 KPCS 227- 230 VPVC
Function	"In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
Mutation