BACK HOME

Q96L12 Proteins with OtherRepeats Repeats

Uniprot ID: Q96L12	Protein name : Calreticulin-3	Gene : CALR3 CRT2
Protein Families : Calreticulin family	Squence Length : 384

Sequence	>Q96L12 385 MARALVQLWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
Repeat regions	REPEAT 191 202 1-1 REPEAT 208 219 1-2 REPEAT 221 230 1-3 REPEAT 234 245 1-4 REPEAT 249 259 2-1 REPEAT 263 271 2-2 REPEAT 273 283 2-3
Sequence region of repeats	191- 202 SGSIEYDWNLTS 208- 219 SPAESKDWEQTK 221- 230 NKAQDWEKHF 234- 245 STSKQSDWNGDL 249- 259 WPAPMLQKPPY 263- 271 LKPEGIHKD 273- 283 WLHRKMKNTDY
Function	"During spermatogenesis, may act as a lectin-independent chaperone for specific client proteins such as ADAM3. Required for sperm fertility (By similarity). CALR3 capacity for calcium-binding may be absent or much lower than that of CALR"
Motifs	MOTIF 381 384 Prevents secretion from ER
Binding Site	BINDING 109 109 Carbohydrate. BINDING 111 111 Carbohydrate. BINDING 128 128 Carbohydrate. BINDING 135 135 Carbohydrate. BINDING 303 303 Carbohydrate
Mutation
Disease	"DISEASE: Cardiomyopathy, familial hypertrophic 19 (CMH19) [MIM:613875]: A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain They can be readily provoked by exercise The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death Note=The disease is caused by mutations affecting the gene represented in this entry"