BACK HOME

Q9BYR5 Proteins with OtherRepeats Repeats

Uniprot ID: Q9BYR5	Protein name : Keratin-associated protein 4-2	Gene : KRTAP4-2 KAP4.2 KRTAP4.2
Protein Families : KRTAP type 4 family	Squence Length : 136

Sequence	>Q9BYR5 137 MVNSCCGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCSPSCCQTTCCRTTCCRPSCCVSSCFRPQCCQSVYCQPTCCRPSCGQTTCCRTTCYRPSCCVSTCCRPTCSSGSCC
Repeat regions	REPEAT 5 9 1 REPEAT 20 24 2 REPEAT 25 29 3 REPEAT 30 34 4 REPEAT 35 39 5 REPEAT 40 44 6 REPEAT 45 49 7 REPEAT 50 54 8 REPEAT 55 59 9 REPEAT 60 64 10 REPEAT 65 69 11 REPEAT 70 74 12 REPEAT 75 79 13 REPEAT 80 84 14 REPEAT 90 94 15 REPEAT 95 99 16 REPEAT 100 104 17 REPEAT 110 114 18 REPEAT 120 124 19 REPEAT 125 129 20
Sequence region of repeats	5- 9 GSVCS 20- 24 RPSCC 25- 29 QTTCC 30- 34 RTTCC 35- 39 RPSCC 40- 44 VSSCC 45- 49 RPQCC 50- 54 QSVCC 55- 59 QPTCC 60- 64 SPSCC 65- 69 QTTCC 70- 74 RTTCC 75- 79 RPSCC 80- 84 VSSCF 90- 94 QSVYC 95- 99 QPTCC 100- 104 RPSCG 110- 114 RTTCY 120- 124 VSTCC 125- 129 RPTCS
Function	"In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
Mutation