Uniprot ID:O75581	Protein name: Low-density lipoprotein receptor-related protein 6	Gene : LRP6
Protein Family:LDLR family	Squence Length : 1613

Sequnce	>O75581 1614 MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Domains	DOMAIN 282 324 EGF-like 1 DOMAIN 588 628 EGF-like 2 DOMAIN 889 930 EGF-like 3 DOMAIN 1203 1244 EGF-like 4 DOMAIN 1248 1286 LDL-receptor class A 1 DOMAIN 1287 1323 LDL-receptor class A 2 DOMAIN 1325 1361 LDL-receptor class A 3
EGF-like sequence regions	282 - 324 NPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDG 588 - 628 NPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVP 889 - 930 NECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAP 1203 - 1244 HPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEP
Function	"Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes. Cell-surface coreceptor of Wnt/beta-catenin signaling, which plays a pivotal role in bone formation. The Wnt-induced Fzd/LRP6 coreceptor complex recruits DVL1 polymers to the plasma membrane which, in turn, recruits the AXIN1/GSK3B-complex to the cell surface promoting the formation of signalsomes and inhibiting AXIN1/GSK3-mediated phosphorylation and destruction of beta-catenin. Required for posterior patterning of the epiblast during gastrulation (By similarity)"
Motifs	MOTIF 1487 1493 PPPSP motif A. MOTIF 1527 1534 PPPSP motif B. MOTIF 1568 1575 PPPSP motif C. MOTIF 1588 1593 PPPSP motif D. MOTIF 1603 1610 PPPSP motif E
Mutation	"1394 1394 C->A: Some reduction of palmitoylation, little change in plasma membrane location in the presence of MESD nor in Wnt-signaling activity when associated with A-1399 when associated with A-1399 and R-1403 1399 1399 C->A: Some reduction of palmitoylation, and little change in plasma membrane location in the presence of MESD nor in Wnt-signaling activity when associated with A-1394 when associated with A-1394 and R-1403 1403 1403 K->R: Abolishes ubiquitination, no change in plasma membrane location in the presence of MESD but greatly reduced Wnt-signaling activity when associated with A-1394 and A-1399 1420 1420 S->A: Enhanced AXIN1 binding and increased beta-catenin activity by 2 when associated with A-1430 1430 1430 S->A: Enhanced AXIN1 binding when associated with A-1420 1485 1485 L->A: No change in the phosphorylation state of PPPSP motif 1486 1486 N->A: No change in the phosphorylation state of PPPSP motif 1487 1487 P->A: No change in the phosphorylation state of PPPSP motif A 1487 1487 P->C: No change in the phosphorylation state of PPPSP motif A 1488 1488 P->A: No change in the phosphorylation state of PPPSP motif A 1489 1489 P->A: No change in the phosphorylation state of PPPSP motif A 1490 1490 S->A: Greatly reduced phosphorylation of PPPSP motif A 1490 1490 S->T: Some loss of phosphorylation of PPPSP motif A 1491 1491 P->A: Greatly reduced phosphorylation of PPPSP motif A 1492 1492 A->G: No change in the phosphorylation state of PPPSP motif A 1493 1493 T->A: No change in the phosphorylation state of PPPSP motif A 1494 1494 E->A: No change in the phosphorylation state of PPPSP motif A 1495 1495 R->A: No change in the phosphorylation state of PPPSP motif 1529 1529 T->A: No effect on the phosphorylation state of PPPSP motif B 1530 1530 T->A: Abolishes phosphorylation of PPPSP motif B 1531 1531 P->A: Abolishes phosphorylation of PPPSP motif B 1572 1572 T->A: Abolishes Wnt/beta-catenin signaling 1590 1590 S->A: Abolishes Wnt/beta-catenin signaling 1607 1607 S->A: Abolishes Wnt/beta-catenin signaling"
Disease	"DISEASE: Coronary artery disease, autosomal dominant, 2 (ADCAD2) [MIM:610947]: A common heart disease characterized by reduced or absent blood flow in one or more of the arteries that encircle and supply the heart Its most important complication is acute myocardial infarction Note=The disease is caused by mutations affecting the gene represented in this entry ; DISEASE: Tooth agenesis, selective, 7 (STHAG7) [MIM:616724]: An autosomal dominant form of selective tooth agenesis, a common anomaly characterized by the congenital absence of one or more teeth Selective tooth agenesis without associated systemic disorders has sometimes been divided into 2 types: oligodontia, defined as agenesis of 6 or more permanent teeth, and hypodontia, defined as agenesis of less than 6 teeth The number in both cases does not include absence of third molars (wisdom teeth) Note=The disease is caused by mutations affecting the gene represented in this entry"

O75581 Proteins EGF-like domain Repeats