Uniprot ID:P22626	Protein name: Heterogeneous nuclear ribonucleoproteins A2/B1	Gene : HNRNPA2B1 HNRPA2B1
Protein Family:	Squence Length : 353

Sequnce	>P22626 354 MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY
Domains	DOMAIN 21 104 RRM 1 DOMAIN 112 191 RRM 2
RRM sequence regions	21 - 104 LFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPG 112 - 191 LFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEM
Function	"Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs (PubMed:19099192). Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs, and promotes their transport to the cytoplasm (PubMed:10567417). Specifically binds single-stranded telomeric DNA sequences, protecting telomeric DNA repeat against endonuclease digestion (By similarity). Also binds other RNA molecules, such as primary miRNA (pri-miRNAs): acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts (PubMed:26321680). Involved in miRNA sorting into exosomes following sumoylation, possibly by binding (m6A)-containing pre-miRNAs (PubMed:24356509). Acts as a regulator of efficiency of mRNA splicing, possibly by binding to m6A-containing pre-mRNAs (PubMed:26321680).; (Microbial infection) Involved in the transport of HIV-1 genomic RNA out of the nucleus, to the microtubule organizing center (MTOC), and then from the MTOC to the cytoplasm: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) sequence motifs present on HIV-1 genomic RNA, and promotes its transport"
Motifs	MOTIF 9 15 Nuclear localization signal
Mutation	207 207 F->S: Does not affect hydrogel-binding 209 209 F->S: Does not affect hydrogel-binding 219 219 F->S: Does not affect hydrogel-binding 227 227 F->S: Does not affect hydrogel-binding 234 234 Y->S: Does not affect hydrogel-binding 240 240 F->S: Does not affect hydrogel-binding 244 244 Y->S: Does not affect hydrogel-binding 247 247 Y->S: Slightly affects hydrogel-binding 256 256 F->S: Does not affect hydrogel-binding 262 262 Y->S: Slightly affects hydrogel-binding 269 269 Y->S: Does not affect hydrogel-binding 276 276 Y->S: Impairs hydrogel-binding 283 283 Y->S: Slightly affects hydrogel-binding 287 287 Y->S: Does not affect hydrogel-binding 290 290 Y->S: Impairs hydrogel-binding 295 295 Y->S: Impairs hydrogel-binding 300 300 Y->S: Slightly affects hydrogel-binding 303 303 F->S: Impairs hydrogel-binding 306 306 Y->S: Slightly affects hydrogel-binding 313 313 Y->S: Slightly affects hydrogel-binding 321 321 F->S: Impairs hydrogel-binding 331 331 Y->S: Impairs hydrogel-binding 336 336 Y->S: Slightly affects hydrogel-binding 347 347 Y->S: Does not affect hydrogel-binding 353 353 Y->S: Does not affect hydrogel-binding
Disease	"DISEASE: Inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia 2 (IBMPFD2) [MIM:615422]: An autosomal dominant disease characterized by disabling muscle weakness clinically resembling to limb girdle muscular dystrophy, osteolytic bone lesions consistent with Paget disease, and premature frontotemporal dementia Clinical features show incomplete penetrance Note=The disease is caused by mutations affecting the gene represented in this entry"

P22626 Proteins RRM domain Repeats