HOME BACK

P53667 Proteins LIM zinc-binding domain Repeats

Uniprot ID:P53667	Protein name: LIM domain kinase 1	Gene : LIMK1 LIMK
Protein Family:"Protein kinase superfamily, TKL Ser/Thr protein kinase family"	Squence Length : 647

Sequnce	>P53667 648 MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Domains	DOMAIN 25 75 LIM zinc-binding 1 DOMAIN 84 137 LIM zinc-binding 2 DOMAIN 165 258 PDZ DOMAIN 339 604 Protein kinase
LIM zinc-binding sequence regions	25 - 75 SCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYW 84 - 137 GCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYY
Function	"Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways. Activated by upstream kinases including ROCK1, PAK1 and PAK4, which phosphorylate LIMK1 on a threonine residue located in its activation loop. LIMK1 subsequently phosphorylates and inactivates the actin binding/depolymerizing factors cofilin-1/CFL1, cofilin-2/CFL2 and destrin/DSTN, thereby preventing the cleavage of filamentous actin (F-actin), and stabilizing the actin cytoskeleton. In this way LIMK1 regulates several actin-dependent biological processes including cell motility, cell cycle progression, and differentiation. Phosphorylates TPPP on serine residues, thereby promoting microtubule disassembly. Stimulates axonal outgrowth and may be involved in brain development. Isoform 3 has a dominant negative effect on actin cytoskeletal changes. Required for atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1)"
Active Site	ACT_SITE 460 460
Binding Site	BINDING 368 368 ATP
Nucleotide Binding	NP_BIND 345 353 ATP
Mutation	"84 84 C->S: Enhances actin aggregation 177 178 GL->EA: Enhances actin aggregation 460 460 D->N: Abrogates kinase activity 496 506 Missing: Reduces actin aggregation 503 505 RKK->GAA: Abolishes kinase activity 508 508 T->A: Abolishes activation by ROCK1 508 508 T->EE: Enhances kinase activity 508 508 T->V,E: Reduces kinase activity"
Disease	"DISEASE: Note=LIMK1 is located in the Williams-Beuren syndrome (WBS) critical region WBS results from a hemizygous deletion of several genes on chromosome 7q11 23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region"