Uniprot ID:Q16512	Protein name: Serine/threonine-protein kinase N1	Gene : PKN1 PAK1 PKN PRK1 PRKCL1
Protein Family:"Protein kinase superfamily, AGC Ser/Thr protein kinase family, PKC subfamily"	Squence Length : 942

Sequnce	>Q16512 943 MASDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHVVLPDPAATHDGPQSPGAGGPTCSATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQAGQLENQAAPDDTQGSPDLGAVELRIEELRHHFRVEHAVAEGAKNVLRLLSAAKAPDRKAVSEAQEKLTESNQKLGLLREALERRLGELPADHPKGRLLREELAAASSAAFSTRLAGPFPATHYSTLCKPAPLTGTLEVRVVGCRDLPETIPWNPTPSMGGPGTPDSRPPFLSRPARGLYSRSGSLSGRSSLKAEAENTSEVSTVLKLDNTVVGQTSWKPCGPNAWDQSFTLELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFRNPVIERIPRLRRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATGTGTFSPGASPGSEARTTGDISVEKLNLGTDSDSSPQKSSRDPPSSPSSLSSPIQESTAPELPSETQETPGPALCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFLDFDFVAGGC
Domains	DOMAIN 25 100 REM-1 1 DOMAIN 112 193 REM-1 2 DOMAIN 201 280 REM-1 3 DOMAIN 325 461 C2 DOMAIN 615 874 Protein kinase DOMAIN 875 942 AGC-kinase C-terminal
REM-1 sequence regions	25 - 100 AAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHVVLPD 112 - 193 GAGGPTCSATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQAGQLEN 201 - 280 QGSPDLGAVELRIEELRHHFRVEHAVAEGAKNVLRLLSAAKAPDRKAVSEAQEKLTESNQKLGLLREALERRLGELPADH
Function	"PKC-related serine/threonine-protein kinase involved in various processes such as regulation of the intermediate filaments of the actin cytoskeleton, cell migration, tumor cell invasion and transcription regulation. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14. Regulates the cytoskeletal network by phosphorylating proteins such as VIM and neurofilament proteins NEFH, NEFL and NEFM, leading to inhibit their polymerization. Phosphorylates 'Ser-575', 'Ser-637' and 'Ser-669' of MAPT/Tau, lowering its ability to bind to microtubules, resulting in disruption of tubulin assembly. Acts as a key coactivator of androgen receptor (ANDR)-dependent transcription, by being recruited to ANDR target genes and specifically mediating phosphorylation of 'Thr-11' of histone H3 (H3T11ph), a specific tag for epigenetic transcriptional activation that promotes demethylation of histone H3 'Lys-9' (H3K9me) by KDM4C/JMJD2C. Phosphorylates HDAC5, HDAC7 and HDAC9, leading to impair their import in the nucleus. Phosphorylates 'Thr-38' of PPP1R14A, 'Ser-159', 'Ser-163' and 'Ser-170' of MARCKS, and GFAP. Able to phosphorylate RPS6 in vitro"
Active Site	ACT_SITE 740 740 Proton acceptor
Binding Site	BINDING 644 644 ATP
Nucleotide Binding	NP_BIND 621 629 ATP
Mutation	108 108 D->A: Abolishes cleavage by caspase-3 and formation of AF1 fragment 181 181 R->A: Abolishes interaction with bacterial SspH1 181 181 R->K: Decreases interaction with bacterial SspH1 185 185 R->A: Abolishes interaction with bacterial SspH1 451 451 D->A: Abolishes cleavage by caspase-3 and formation of 70 kDa fragment 454 454 D->A: Abolishes cleavage by caspase-3 and formation of 70 kDa fragment 558 558 D->A: Abolishes cleavage by caspase-3 and formation of AF3 fragment 560 560 D->A: Abolishes cleavage by caspase-3 and formation of AF3 fragment 644 644 K->E: Abolishes Serine/threonine-protein kinase activity 644 644 K->R: Substantial reduction of autophosphorylation

Q16512 Proteins REM-1 domain Repeats