HOME BACK

Q53EL6 Proteins MI domain Repeats

Uniprot ID:Q53EL6	Protein name: Programmed cell death protein 4	Gene : PDCD4 H731
Protein Family:PDCD4 family	Squence Length : 469

Sequnce	>Q53EL6 470 MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY
Domains	DOMAIN 163 284 MI 1 DOMAIN 326 449 MI 2
MI sequence regions	163 - 284 EKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTV 326 - 449 VKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRG
Function	"Inhibits translation initiation and cap-dependent translation. May excert its function by hindering the interaction between EIF4A1 and EIF4G. Inhibits the helicase activity of EIF4A. Modulates the activation of JUN kinase. Down-regulates the expression of MAP4K1, thus inhibiting events important in driving invasion, namely, MAPK85 activation and consequent JUN-dependent transcription. May play a role in apoptosis. Tumor suppressor. Inhibits tumor promoter-induced neoplastic transformation. Binds RNA (By similarity)"
Motifs	MOTIF 58 64 Nuclear localization signal. MOTIF 70 76 Phosphodegron. MOTIF 241 250 Nuclear localization signal
Mutation	"67 67 S->A: Loss of phosphorylation site when associated with A-457 71 71 S->A: Strongly reduced interaction with BTRC 76 76 S->A: Strongly reduced interaction with BTRC 174 174 E->A: Reduced inhibition of EIF4A1 helicase activity 210 210 E->A: Reduced inhibition of EIF4A1 helicase activity 249 249 E->A: Reduced interaction with EIF4A1 252 252 L->A: Strongly reduced interaction with EIF4A1 253 253 D->A: Strongly reduced interaction with EIF4A1 255 255 P->A: Reduced inhibition of EIF4A1 helicase activity 333 333 M->A: No effect on inhibition of EIF4A1 and on inhibition of translation when associated with A-340 337 337 E->A: No effect on inhibition of EIF4A1 and on inhibition of translation 340 340 L->A: No effect on inhibition of EIF4A1 and on inhibition of translation when associated with A-333 358 358 H->A: Strongly reduced interaction with EIF4A1 359 359 F->A: Strongly reduced inhibition of EIF4A1 361 361 H->A: Strongly reduced inhibition of EIF4A1 414 414 D->A: Strongly reduced interaction with EIF4A1 418 418 D->A: Reduced interaction with EIF4A1 420 420 P->A: Strongly reduced interaction with EIF4A1 457 457 S->A: Loss of phosphorylation site, and loss of nuclear accumulation when associated with A-67"