Uniprot ID:Q9UGJ0	Protein name: 5'-AMP-activated protein kinase subunit gamma-2	Gene : PRKAG2
Protein Family:5'-AMP-activated protein kinase gamma subunit family	Squence Length : 569

Sequnce	>Q9UGJ0 570 MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSSRKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRRMSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALILTPAGAKQKETETE
Domains	DOMAIN 275 335 CBS 1 DOMAIN 357 415 CBS 2 DOMAIN 430 492 CBS 3 DOMAIN 504 562 CBS 4
CBS sequence regions	275 - 335 SSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQ 357 - 415 KPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPK 430 - 492 TYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITV 504 - 562 EGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALILTPAGAKQK
Function	"AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive"
Motifs	MOTIF 370 391 AMPK pseudosubstrate
Binding Site	"BINDING 302 302 AMP, ADP or ATP 2. BINDING 362 362 AMP, ADP or ATP 1. via amide nitrogen and carbonyl oxygen. BINDING 383 383 AMP 3. BINDING 402 402 AMP, ADP or ATP 2. BINDING 432 432 AMP 3. BINDING 437 437 AMP 3. via amide nitrogen and carbonyl oxygen. BINDING 501 501 AMP, ADP or ATP 2. BINDING 509 509 AMP, ADP or ATP 2. via amide nitrogen and carbonyl oxygen. BINDING 530 530 AMP 3"
Nucleotide Binding	"NP_BIND 319 322 AMP, ADP or ATP 1. NP_BIND 383 384 AMP, ADP or ATP 1. NP_BIND 458 459 AMP 3. NP_BIND 474 477 AMP, ADP or ATP 2. NP_BIND 530 531 AMP, ADP or ATP 2. NP_BIND 546 549 AMP 3"
Mutation	387 387 V->S: Induces phosphorylation by AMPK
Disease	"DISEASE: Wolff-Parkinson-White syndrome (WPWS) [MIM:194200]: A supernormal conduction disorder characterized by the presence of one or several accessory atrioventricular connections, which can lead to episodes of sporadic tachycardia Note=The disease is caused by mutations affecting the gene represented in this entry ; DISEASE: Cardiomyopathy, familial hypertrophic 6 (CMH6) [MIM:600858]: A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain They can be readily provoked by exercise The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death CMH6 patients present Wolff-Parkinson-White ventricular preexcitation, enlarged myocytes without myofiber disarray, and glycogen-containing cytosolic vacuoles within cardiomyocytes Note=The disease is caused by mutations affecting the gene represented in this entry ; DISEASE: Glycogen storage disease of heart lethal congenital (GSDH) [MIM:261740]: Rare disease which leads to death within a few weeks to a few months after birth, through heart failure and respiratory compromise Note=The disease is caused by mutations affecting the gene represented in this entry"

Q9UGJ0 Proteins CBS domain Repeats