Uniprot ID:Q9Y5Q5	Protein name: Atrial natriuretic peptide-converting enzyme	Gene : CORIN CRN TMPRSS10
Protein Family:Peptidase S1 family	Squence Length : 1042

Sequnce	>Q9Y5Q5 1043 MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVSTAHPDQHVPAWTTDASLPGDQSHRNTSACMNITHSQCQMLPYHATLTPLLSVVRNMEMEKFLKFFTYLHRLSCYQHIMLFGCTLAFPECIIDGDDSHGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLRCSQFRNQTESSNVSRICFSPQQENGKQLLCGRGENFLCASGICIPGKLQCNGYNDCDDWSDEAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNPTTEHRCGDGRCIAMEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFLLN
Domains	DOMAIN 134 259 FZ 1 DOMAIN 268 304 LDL-receptor class A 1 DOMAIN 305 340 LDL-receptor class A 2 DOMAIN 341 377 LDL-receptor class A 3 DOMAIN 378 415 LDL-receptor class A 4 DOMAIN 450 573 FZ 2 DOMAIN 579 614 LDL-receptor class A 5 DOMAIN 615 653 LDL-receptor class A 6 DOMAIN 654 689 LDL-receptor class A 7 DOMAIN 690 801 SRCR DOMAIN 802 1035 Peptidase S1
FZ sequence regions	134 - 259 TSACMNITHSQCQMLPYHATLTPLLSVVRNMEMEKFLKFFTYLHRLSCYQHIMLFGCTLAFPECIIDGDDSHGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLRCSQFRNQTESSNVSRICFSPQQ 450 - 573 CSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDE
Function	"Serine-type endopeptidase involved in atrial natriuretic peptide hormone (NPPA) processing. Converts through proteolytic cleavage the non-functional propeptide NPPA into the active hormone, thereby regulating blood pressure in heart and promoting natriuresis, diuresis and vasodilation. Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Also acts as a regulator of sodium reabsorption in kidney. May also process pro-NPPB the B-type natriuretic peptide.; Isoform 2: has weaker endopeptidase activity compared to isoform 1"
Active Site	ACT_SITE 843 843 Charge relay system. ACT_SITE 892 892 Charge relay system. ACT_SITE 985 985 Charge relay system
Motifs	MOTIF 26 29 DDNN motif
Mutation	"26 26 D->A: Impairs cell membrane targeting when associated with A-30 30 30 M->A: Impairs cell membrane targeting when associated with A-26 134 134 R->A: Does not affect autocatalytic cleavage 164 164 R->A: Affects autocatalytic cleavage and production of Atrial natriuretic peptide-converting enzyme, 160 kDa soluble fragment 180 180 R->A: Does not affect autocatalytic cleavage 213 213 R->A: Does not affect autocatalytic cleavage 239 239 R->A: Does not affect autocatalytic cleavage 244 244 R->A: Does not affect autocatalytic cleavage 427 427 R->A: Affects autocatalytic cleavage and production of Atrial natriuretic peptide-converting enzyme, 100 kDa soluble fragment 801 801 R->A: Loss of activity towards NPPA 985 985 S->A: Loss of activity towards NPPA"
Disease	"DISEASE: Pre-eclampsia/eclampsia 5 (PEE5) [MIM:614595]: A hypertensive disorder of pregnancy characterized by new hypertension (blood pressure 140/90 or greater) presenting after 20 weeks' gestation with clinically relevant proteinuria It impacts 2 individuals, the mother and her child, both of whom can be severely affected Preeclampsia is one of the causes of maternal mortality and morbidity worldwide Note=The disease is caused by mutations affecting the gene represented in this entry"

Q9Y5Q5 Proteins FZ domain Repeats