HOME
BACK
P09234 Proteins with novel repeats
Uniprot ID:P09234
Gene name: SNRPC
Protein Family:U1 small nuclear ribonucleoprotein C family
Protein name: U1 small nuclear ribonucleoprotein C
Length : 159
Sequnce
>P09234 160 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Repeated Sequence regions
Length: 17 residues : 2 times from 106 to 142 :0.825 region Length:37 MGPPPPGMMPVGPAPGMRPP MGGHMP-MMP-GP-PMMRPP
Function
"Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. SNRPC/U1-C is directly involved in initial 5' splice-site recognition for both constitutive and regulated alternative splicing. The interaction with the 5' splice-site seems to precede base-pairing between the pre-mRNA and the U1 snRNA. Stimulates commitment or early (E) complex formation by stabilizing the base pairing of the 5' end of the U1 snRNA and the 5' splice-site region"
Mutation
6 6 C->S: Abolishes the binding to U1 snRNP 9 9 C->S: Abolishes the binding to U1 snRNP 24 24 H->Q: Abolishes the binding to U1 snRNP 25 25 C->S: No effect 30 30 H->Q: Abolishes the binding to U1 snRNP