HOME
BACK
Q9UHG2 Proteins with novel repeats
Uniprot ID:Q9UHG2
Gene name: PCSK1N
Protein Family:
Protein name: ProSAAS
Length : 260
Sequnce
>Q9UHG2 261 MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP
Repeated Sequence regions
Length: 15 residues : 2 times from 122 to 153 :0.7352941176470589 region Length:32 ALGLDDDPDAPAAQLAR AL-LRARLD-PAALAAQ
Function
"May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the further processed peptides reduce PCSK1 activity in the endoplasmic reticulum and Golgi. It reduces the activity of the 84 kDa form but not the autocatalytically derived 66 kDa form of PCSK1. Subsequent processing of proSAAS may eliminate the inhibition. Slows down convertase-mediated processing of proopiomelanocortin and proenkephalin. May control the intracellular timing of PCSK1 rather than its total level of activity. The function of the processed secreted peptides is not known (By similarity)"
Motifs
MOTIF 239 244 Sufficient for inhibition of PCSK1
Mutation
235 235 V->A: Reduces inhibition of PCSK1 236 236 L->A: Greatly reduces inhibition of PCSK1 237 237 G->A: Reduces inhibition of PCSK1 240 240 L->A: Reduces inhibition of PCSK1 241 241 R->A: Reduces inhibition of PCSK1 242 242 V->A: Reduces inhibition of PCSK1 243 243 K->A: Abolishes inhibition of PCSK1 244 244 R->A: Abolishes inhibition of PCSK1 245 245 L->A: Reduces inhibition of PCSK1 246 246 E->A: Reduces inhibition of PCSK1