HOME
BACK
Q07352 of Proteins C3H1-type domain repeats
Uniprot ID:Q07352
Protein name: mRNA decay activator protein ZFP36L1
Gene : ZFP36L1 BERG36 BRF1 ERF1 RNF162B TIS11B
Protein Family:
Squence Length : 338
Sequnce
>Q07352 339 MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
C3H1-type domains repeats
ZN_FING 114 142 C3H1-type 1 ZN_FING 152 180 C3H1-type 2
Domin repeated regions
114 - 142 RYKTELCRPFEENGACKYGDKCQFAHGIH 152 - 180 KYKTELCRTFHTIGFCPYGPRCHFIHNAE
Function
"Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (PubMed:12198173, PubMed:15538381, PubMed:15467755, PubMed:17030608, PubMed:19179481, PubMed:20702587, PubMed:24700863, PubMed:25106868, PubMed:25014217, PubMed:26542173). Acts as a 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery (PubMed:15687258). Functions by recruiting the CCR4-NOT deadenylase complex and components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs, and hence promotes ARE-mediated mRNA deadenylation and decay processes (PubMed:15687258, PubMed:18326031, PubMed:25106868). Induces also the degradation of ARE-containing mRNAs even in absence of poly(A) tail (By similarity). Binds to 3'-UTR ARE of numerous mRNAs (PubMed:12198173, PubMed:15538381, PubMed:15467755, PubMed:17030608, PubMed:19179481, PubMed:20702587, PubMed:24700863, PubMed:25106868, PubMed:25014217, PubMed:26542173). Positively regulates early adipogenesis by promoting ARE-mediated mRNA decay of immediate early genes (IEGs) (By similarity). Promotes ARE-mediated mRNA decay of mineralocorticoid receptor NR3C2 mRNA in response to hypertonic stress (PubMed:24700863). Negatively regulates hematopoietic/erythroid cell differentiation by promoting ARE-mediated mRNA decay of the transcription factor STAT5B mRNA (PubMed:20702587). Positively regulates monocyte/macrophage cell differentiation by promoting ARE-mediated mRNA decay of the cyclin-dependent kinase CDK6 mRNA (PubMed:26542173). Promotes degradation of ARE-containing pluripotency-associated mRNAs in embryonic stem cells (ESCs), such as NANOG, through a fibroblast growth factor (FGF)-induced MAPK-dependent signaling pathway, and hence attenuates ESC self-renewal and positively regulates mesendoderm differentiation (By similarity). May play a role in mediating pro-apoptotic effects in malignant B-cells by promoting ARE-mediated mRNA decay of BCL2 mRNA (PubMed:25014217). In association with ZFP36L2 maintains quiescence on developing B lymphocytes by promoting ARE-mediated decay of several mRNAs encoding cell cycle regulators that help B cells progress through the cell cycle, and hence ensuring accurate variable-diversity-joining (VDJ) recombination and functional immune cell formation (By similarity). Together with ZFP36L2 is also necessary for thymocyte development and prevention of T-cell acute lymphoblastic leukemia (T-ALL) transformation by promoting ARE-mediated mRNA decay of the oncogenic transcription factor NOTCH1 mRNA (By similarity). Participates in the delivery of target ARE-mRNAs to processing bodies (PBs) (PubMed:17369404). In addition to its cytosolic mRNA-decay function, plays a role in the regulation of nuclear mRNA 3'-end processing; modulates mRNA 3'-end maturation efficiency of the DLL4 mRNA through binding with an ARE embedded in a weak noncanonical polyadenylation (poly(A)) signal in endothelial cells (PubMed:21832157). Also involved in the regulation of stress granule (SG) and P-body (PB) formation and fusion (PubMed:15967811). Plays a role in vasculogenesis and endocardial development (By similarity). Plays a role in the regulation of keratinocyte proliferation, differentiation and apoptosis (PubMed:27182009). Plays a role in myoblast cell differentiation (By similarity)"
Mutation
"54 54 S->A: Inhibits MAPKAPK2-mediated ARE-containing mRNA stabilization when associated with A-92 and A-203 90 90 S->A: Inhibits interaction with 14-3-3 proteins and AKT1-mediated ARE-containing mRNA stabilization, but does not affect ARE binding when associated with A-92 92 92 S->A: Inhibits MAPKAPK2-mediated ARE-containing mRNA stabilization when associated with A-54 and A-203 when associated with A-203 when associated with A-90 120 120 C->R: Reduces binding to ARE-containing mRNAs and ARE-mediated mRNA decay when associated with R-158 158 158 C->R: Reduces binding to ARE-containing mRNAs and ARE-mediated mRNA decay when associated with R-120 203 203 S->A: Inhibits interaction with 14-3-3 proteins and AKT1-mediated ARE-containing mRNA stabilization when associated with A-92 when associated with A-54 and A-92 334 334 S->A: Inhibits p38 MAPK-mediated LDLR mRNA stabilization, but does not inhibit interaction with CNOT1 and CNOT7 when associated with A-336 336 336 S->A: Inhibits p38 MAPK-mediated LDLR mRNA stabilization, but does not inhibit interaction with CNOT1 and CNOT7 when associated with A-334"