HOME BACK

Q13114 of Proteins TRAF-type domain repeats

Uniprot ID:Q13114	Protein name: TNF receptor-associated factor 3	Gene : TRAF3 CAP1 CRAF1
Protein Family:"TNF receptor-associated factor family, A subfamily"	Squence Length : 568

Sequnce	>Q13114 569 MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
TRAF-type domains repeats	ZN_FING 68 77 RING-type ZN_FING 135 190 TRAF-type 1 ZN_FING 191 249 TRAF-type 2
Domin repeated regions	135 - 190 VHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQ 191 - 249 KHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIK
Function	"Regulates pathways leading to the activation of NF-kappa-B and MAP kinases, and plays a central role in the regulation of B-cell survival. Part of signaling pathways leading to the production of cytokines and interferon. Required for normal antibody isotype switching from IgM to IgG. Plays a role T-cell dependent immune responses. Plays a role in the regulation of antiviral responses. Is an essential constituent of several E3 ubiquitin-protein ligase complexes. May have E3 ubiquitin-protein ligase activity and promote 'Lys-63'-linked ubiquitination of target proteins. Inhibits activation of NF-kappa-B in response to LTBR stimulation. Inhibits TRAF2-mediated activation of NF-kappa-B. Down-regulates proteolytic processing of NFKB2, and thereby inhibits non-canonical activation of NF-kappa-B. Promotes ubiquitination and proteasomal degradation of MAP3K14"
Mutation	"441 441 Y->A: Abolishes interaction with RNF216 when associated with A-443 443 443 Q->A: Abolishes interaction with RNF216 when associated with A-441 459 459 Y->A: Abolishes interaction with LTBR, CD40 and TANK 512 512 F->E: Abolishes interaction with LTBR, CD40 and TANK 521 521 F->A: Abolishes interaction with LTBR, CD40 and TANK"
Disease	"DISEASE: Encephalopathy, acute, infection-induced, Herpes-specific, 5 (IIAE5) [MIM:614849]: A rare complication of human herpesvirus 1 (HHV-1) infection, occurring in only a small minority of HHV-1 infected individuals It is characterized by hemorrhagic necrosis of parts of the temporal and frontal lobes Onset is over several days and involves fever, headache, seizures, stupor, and often coma, frequently with a fatal outcome Note=Disease susceptibility is associated with variations affecting the gene represented in this entry"