HOME
BACK
Q9Y4K3 of Proteins TRAF-type domain repeats
Uniprot ID:Q9Y4K3
Protein name: TNF receptor-associated factor 6
Gene : TRAF6 RNF85
Protein Family:"TNF receptor-associated factor family, A subfamily"
Squence Length : 522
Sequnce
>Q9Y4K3 523 MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
TRAF-type domains repeats
ZN_FING 70 109 RING-type ZN_FING 150 202 TRAF-type 1 ZN_FING 203 259 TRAF-type 2
Domin repeated regions
150 - 202 DHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKE 203 - 259 IHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLA
Function
"E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as IKBKG, IRAK1, AKT1 and AKT2. Also mediates ubiquitination of free/unanchored polyubiquitin chain that leads to MAP3K7 activation. Leads to the activation of NF-kappa-B and JUN. May be essential for the formation of functional osteoclasts. Seems to also play a role in dendritic cells (DCs) maturation and/or activation. Represses c-Myb-mediated transactivation, in B-lymphocytes. Adapter protein that seems to play a role in signal transduction initiated via TNF receptor, IL-1 receptor and IL-17 receptor. Regulates osteoclast differentiation by mediating the activation of adapter protein complex 1 (AP-1) and NF-kappa-B, in response to RANK-L stimulation. Together with MAP3K8, mediates CD40 signals that activate ERK in B-cells and macrophages, and thus may play a role in the regulation of immunoglobulin production"
Mutation
"57 57 D->K: Loss of interaction with UBE2N 70 70 C->A: Loss of ligase activity, autoubiquitination and signaling capacity 72 72 I->D: Loss of interaction with UBE2N 74 74 L->E,K: Loss of interaction with UBE2N 88 88 R->A: Loss of TRAF6 homodimerization and impaired polyubiquitin synthesis when associated with A-122 118 118 F->A: Loss of TRAF6 homodimerization and impaired polyubiquitin synthesis 118 118 F->W: Partially impaired polyubiquitin synthesis 118 118 F->Y: Partially impaired polyubiquitin synthesis 122 122 F->A: Loss of TRAF6 homodimerization and partially impaired polyubiquitin synthesis when associated with A-88 124 124 K->R: Loss of SUMO1-modification and c-myb-mediated transcriptional repressive activation 142 142 K->R: Loss of SUMO1-modification and c-myb-mediated transcriptional repressive activation 453 453 K->R: Loss of SUMO1-modification and c-myb-mediated transcriptional repressive activation"